SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034476 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034476
Domain Number 1 Region: 56-100
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.00000000000000301
Family Substrate-binding domain of HMG-CoA reductase 0.0006
Further Details:      
 
Domain Number 2 Region: 1-26
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.0000000837
Family NAD-binding domain of HMG-CoA reductase 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034476   Gene: ENSMMUG00000006139   Transcript: ENSMMUT00000041447
Sequence length 111
Comment pep:known_by_projection chromosome:MMUL_1:6:71558973:71560764:1 gene:ENSMMUG00000006139 transcript:ENSMMUT00000041447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREMLGVQGACKDNPGENARQ
LARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
Download sequence
Identical sequences ENSMMUP00000034476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]