SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034479 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034479
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.96e-44
Family NAD-binding domain of HMG-CoA reductase 0.000000425
Further Details:      
 
Domain Number 2 Region: 114-221
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.49e-37
Family Substrate-binding domain of HMG-CoA reductase 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034479   Gene: ENSMMUG00000006139   Transcript: ENSMMUT00000041450
Sequence length 248
Comment pep:known_by_projection chromosome:MMUL_1:6:71554887:71560763:1 gene:ENSMMUG00000006139 transcript:ENSMMUT00000041450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRF
QSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVV
CEAVIPAKVVREVLKTTTDAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQM
LGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQ
GACTKKTA
Download sequence
Identical sequences ENSMMUP00000034479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]