SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034763 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034763
Domain Number 1 Region: 52-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-71
Family Calnexin/calreticulin 0.0000000389
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 9.02e-59
Family P-domain of calnexin/calreticulin 0.000000266
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034763
Domain Number - Region: 401-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000114
Family Calnexin/calreticulin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034763   Gene: ENSMMUG00000022355   Transcript: ENSMMUT00000041750
Sequence length 610
Comment pep:known_by_projection chromosome:MMUL_1:5:132856449:132889071:-1 gene:ENSMMUG00000022355 transcript:ENSMMUT00000041750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFQAFWLCLGLLFISINAEFMDDDVEMEDLEENSEETDVNEGELSSEIKYKTPQPIGEV
YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
AISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDRTSYIIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFE
VLVDQTVVNKGSLLEDVVPPINPPKEIEDPSDKKPEEWDERAKIPDPSAVKPEDWDESEP
AQIEDSSAVKPAGWLDDEPKFIPDPNAEKPDDWNEDMDGEWEAPQILNPACRIGCGEWKP
PMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS
DIYFDNFIICSEKEVADHWAADGWRWKIMIANANEPGVLKQLMAAAEGHPWLWLIYLITA
GVPIALITSFCWPRKVKKKYKDTEYKKTDICIPQTKGILEQEGKEEKAALEKPMDLEEEK
KQSDGEMLEKEEESEPEEKSEEEIEIIEGQEERNKLNKSGSEDEMKEADESTGSGDGPMK
SVRKRRVRKD
Download sequence
Identical sequences F6ZBR0
9544.ENSMMUP00000029427 XP_001089765.1.72884 XP_001089882.1.72884 XP_014994737.1.72884 ENSMMUP00000029427 ENSMMUP00000034763 ENSMMUP00000029427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]