SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034848 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034848
Domain Number 1 Region: 1280-1442,1470-1549
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 747-973
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.29e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 85-241,338-405
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.29e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1615-1818
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-29
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034848
Domain Number - Region: 1551-1593
Classification Level Classification E-value
Superfamily PRTase-like 0.0279
Family Phosphoribosyltransferases (PRTases) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034848   Gene: ENSMMUG00000017256   Transcript: ENSMMUT00000041840
Sequence length 2286
Comment pep:known chromosome:MMUL_1:16:34802861:34868421:1 gene:ENSMMUG00000017256 transcript:ENSMMUT00000041840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRRGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVSVSLTARTWFERISMLVILLNCVTLGMFRPCEDIACDSQRCR
ILQAFDDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVS
FSAVRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAG
LLRNRCFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGEGGGG
PPCGLDYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEG
WVDIMYFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVR
FLSNASTLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRAGLLSSPAPLGGQE
TQPSSSCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRVPRASPEIQDRDANGSRRLMLP
PPSTPAVSGGPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHT
SPPPETLKEKALVEVAASSGPATLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCL
KADSGASGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRS
LGPDAEPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNAL
EISNIVFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRT
FRLMRVLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASER
DGDTLPDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVL
FNLLVAILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGD
RKKCLALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPMSRRTSSSGSA
EPGAAHEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGE
GQESQDEEESSEEERASPAGSDCRHRESLEREAKSSFDLPDTLQVPGLHRTASGRGSASE
HQDCNGKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWS
AYIFPPQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNY
IFTAVFLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILG
MLRVLRLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFK
GKFFVCQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDG
LDAVGVDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRR
EEKRLRRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDL
FITGVIGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRW
NQLDLAIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDT
VMQALPQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTL
FRVSTGDNWNGIMKVTVPLCCARSPDRAGLVFPAHWVSVESAASGPQLSARDKGICKNLE
EKRGDAAEDNPPEALLAIRLAALSPAPPMPLFSLCIWSPVQASPPCPCPPPPHPTHNMRP
SHHVVREPAVQPHPTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHGSIAEGPLGQRGWGL
PKAQSGSVLSVHSQPADTSYILQLPKDAPHLLQPYSTPTWGTIPKLPPPGRSPLAQRPLR
RQVSRFADTRDTQGHRRGRGILANLEGYTEPKGKSTQRQGGSSTQAQQHSRSHSNISKHM
PPRAPCPGPQPNWDKGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKCYSVEA
QSCQRRPTSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGQPLGGPGSRPKKKLSPPSI
SIDPPESQGPRPPPSPGVCLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSD
PADLDP
Download sequence
Identical sequences ENSMMUP00000034848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]