SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035003 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035003
Domain Number 1 Region: 319-429,540-688
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.37e-51
Family Phosphate binding protein-like 0.000012
Further Details:      
 
Domain Number 2 Region: 18-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000000347
Family L-arabinose binding protein-like 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035003
Domain Number - Region: 447-533
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0136
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035003   Gene: ENSMMUG00000002366   Transcript: ENSMMUT00000041996
Sequence length 884
Comment pep:known chromosome:MMUL_1:5:85554020:86765972:1 gene:ENSMMUG00000002366 transcript:ENSMMUT00000041996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEDIRGIQE
FLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFI
TEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNH
RISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPW
QGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVT
GLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLG
FNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDY
SVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTST
TLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIES
SIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVL
ESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPYRDV
FSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAAGIV
LSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLT
PLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTG
PFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences ENSMMUP00000035003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]