SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035081 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035081
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.72e-84
Family MHC antigen-recognition domain 0.0000000323
Further Details:      
 
Domain Number 2 Region: 208-300
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-32
Family C1 set domains (antibody constant domain-like) 0.0000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035081   Gene: ENSMMUG00000030281   Transcript: ENSMMUT00000042082
Sequence length 362
Comment pep:known scaffold:MMUL_1:1099214727048:28281:31896:1 gene:ENSMMUG00000030281 transcript:ENSMMUT00000042082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMAPRTLLLLLSGALALTETWAGSHSLRYFHTAVSRPGLREPRFIAVGYVDDTQFVRF
DSDAESPREEPQAPWMEQVGPEYWEEQTRIAKGNAQTHRVDLRTLLRYYNQSDAGSHTLQ
TMYGCDLGPDGRLLRGYHQSAYDGKDYIALNEDLRSWTAADMAAQNTQRKWEAARAAERQ
RAYLEGRCLEWLRRYLENGKETLQRADPPKTHVIHHSVSDHEATLRCWALGFYPAEITLT
WQRDGEEQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQPTNPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGRGGSYFQAASSDSAQGSEVSL
TA
Download sequence
Identical sequences ENSMMUP00000035081 9544.ENSMMUP00000035081 ENSMMUP00000035081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]