SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035193 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035193
Domain Number 1 Region: 226-326
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-25
Family C1 set domains (antibody constant domain-like) 0.00000623
Further Details:      
 
Domain Number 2 Region: 7-93
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-22
Family C1 set domains (antibody constant domain-like) 0.00047
Further Details:      
 
Domain Number 3 Region: 123-220
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-19
Family C1 set domains (antibody constant domain-like) 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035193   Gene: ENSMMUG00000002764   Transcript: ENSMMUT00000042194
Sequence length 352
Comment pep:known scaffold:MMUL_1:1099548049570:4347:5793:-1 gene:ENSMMUG00000002764 transcript:ENSMMUT00000042194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPTRPKVFPLSLDSTQSDNVVIACLVQGFFPQEPLNVTWSKSGAGVTVINFPPRQDASG
GLYTTSSQLTLPAAQCPASESVTCHVEHYTNPRQDVAVPCAAPSLTPEPSTADPQPKPCL
CDKPRLSLRRPALEDLLLGSEANLTCTLTGLRDPSGATFTWTPSSGKNAVQQSPEHDPCG
CYSVSSVLPGCAEPWNNRVTFTCTAEHPQLKTPLTATISKSGNTFRPEVHLLPPPSEELA
LNELVTLTCLARGFSPEDVLVRWLKGTEQLPRDKYLTWESRKEPSQGTTTFAVTSILRVA
AEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
Download sequence
Identical sequences ENSMMUP00000003711 9544.ENSMMUP00000035193 ENSMMUP00000035193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]