SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035395 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035395
Domain Number 1 Region: 56-159
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 186-289
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 3 Region: 477-571
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 4 Region: 384-444
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035395   Gene: ENSMMUG00000021065   Transcript: ENSMMUT00000042394
Sequence length 572
Comment pep:known_by_projection chromosome:MMUL_1:3:49969023:49984492:1 gene:ENSMMUG00000021065 transcript:ENSMMUT00000042394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKEAEMQTGPQPDEKGWGWRLGDGSAAPLFLPQALSFLLLLPLASALQPTPLTFPELRL
VGGPSRCRGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDAARPRLPGDREQEASGTCALPP
PLSPGEGSVRLVGGANLCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQLGCGAAMAATT
NAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCAVLGPPTLTALP
SSATRQDWAWHTDQSGKELSPPGARWVRLGTGKNVLDPQAGALANRPGLWPDGAEVALKT
SAGWEEAVRDFFKTEVKFGMWVAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARLSD
CFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGRERADIKHPAH
GRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCR
GEESALLLCSHIRWDAHNCDHSEDAGVLCQPS
Download sequence
Identical sequences ENSMMUP00000027723 ENSMMUP00000035395 9544.ENSMMUP00000035395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]