SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035449 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035449
Domain Number 1 Region: 33-96
Classification Level Classification E-value
Superfamily RILP dimerisation region 5.23e-18
Family RILP dimerisation region 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035449   Gene: ENSMMUG00000002377   Transcript: ENSMMUT00000042445
Sequence length 190
Comment pep:known_by_projection chromosome:MMUL_1:16:1446952:1449651:-1 gene:ENSMMUG00000002377 transcript:ENSMMUT00000042445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAQGQAGAPGHQHDPAEAAQQLGRPSEAGQCFSREEFEQILQERNELKAKVFLLKEELAY
FQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEAESSDDEDGSWLLLSDDKGD
HPPPPESKIQSFFGLWYRGKAESPEDETDSPAPSKLGGEEEAQPQSPAPDLPCSALHEHL
CLGASATPEA
Download sequence
Identical sequences ENSMMUP00000035449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]