SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035676 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035676
Domain Number 1 Region: 193-264
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-21
Family Eukaryotic proteases 0.0045
Further Details:      
 
Domain Number 2 Region: 105-211
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-19
Family Hepsin, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 71-109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035676   Gene: ENSMMUG00000018079   Transcript: ENSMMUT00000042669
Sequence length 294
Comment pep:known_by_projection chromosome:MMUL_1:3:4265820:4278258:1 gene:ENSMMUG00000018079 transcript:ENSMMUT00000042669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENDPPAAEAPFSFRSLFGLDDLKISPVAPGKRGIGEGIILSLLPLKFFPIIVIGIIAL
ILALAIGLGIHFDCSGKYRCRSSFKCVELTARCDGVSDCRDGEDEYRCVRVSGRNAVLQV
FTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSINHLLPDD
KVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSSLSQWPWQASLQFQGY
HLCGGSVIAPLWIVTAAHCVYEIVAPTERTDRGGRKLWCWRKPTKVKGPRPSCS
Download sequence
Identical sequences ENSMMUP00000035676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]