SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035677 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035677
Domain Number 1 Region: 288-534
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.85e-89
Family Eukaryotic proteases 0.0000392
Further Details:      
 
Domain Number 2 Region: 189-295
Classification Level Classification E-value
Superfamily SRCR-like 8.63e-19
Family Hepsin, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 155-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035677   Gene: ENSMMUG00000018079   Transcript: ENSMMUT00000042670
Sequence length 539
Comment pep:known_by_projection chromosome:MMUL_1:3:4264390:4288941:1 gene:ENSMMUG00000018079 transcript:ENSMMUT00000042670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVGPKPLPTLLCGGRTENRMAWILSFLIRSRPCEPGKVCVYAKLVILLPTISSVVPST
FLGLGNYEIEVEVEPEVRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPGKRGI
GEGIILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCVELTARCDGV
SDCRDGEDEYRCVRVSGRNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDN
LRVSSLEGQFREEFVSINHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSS
RIVGGNMSSLSQWPWQASLQFQGYHLCGGSVIAPLWIVTAAHCVYDLYLPKSWTIQVGLV
SLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLTGPLTFNEMIQPVCLPNSEENFPDG
KVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGVD
SCQGDSGGPLVCQERRLWKLVGATSFGIGCAEANKPGVYTRVTSFLDWIHEQMERDLKT
Download sequence
Identical sequences ENSMMUP00000023760 ENSMMUP00000035677 9544.ENSMMUP00000035677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]