SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035704 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035704
Domain Number 1 Region: 71-252
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-45
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035704   Gene: ENSMMUG00000005271   Transcript: ENSMMUT00000042695
Sequence length 314
Comment pep:known chromosome:MMUL_1:3:2594423:2596890:-1 gene:ENSMMUG00000005271 transcript:ENSMMUT00000042695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AATELHRWGPSLAGRAAASGSGPSLFLGVCAFRPLPGSFLRPVPSGKVGRASLTWDGPES
GTPASPMNTGLGQLLVWEWQSESYVLKQQGHFNSMVTLAYSPDGQYIVTGGDDGKVKVWN
TLSGFCFVTFTEHSSGVTGVTFTATGYVVVTSSMDGTVRAFDLHRYRNFRTFTSPRPTQF
SCVAVDASGEIVSAGAQDSFEIFVWSMQTGRLLDVLSGHEGPISGLCFNPMKSILASASW
DKTVRLWDMFDSWRTKETLALTSDGEHEAASRSSGLGTSGMLSHPLPCSWLWVWYESSGG
KQGVLTQTCWCGSP
Download sequence
Identical sequences ENSMMUP00000035704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]