SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035875 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035875
Domain Number 1 Region: 134-248
Classification Level Classification E-value
Superfamily C-type lectin-like 8.07e-31
Family C-type lectin domain 0.00000563
Further Details:      
 
Domain Number 2 Region: 104-128
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000327
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035875   Gene: ENSMMUG00000030564   Transcript: ENSMMUT00000042864
Sequence length 248
Comment pep:novel chromosome:MMUL_1:9:57518961:57521204:1 gene:ENSMMUG00000030564 transcript:ENSMMUT00000042864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLCPLALTLTLMAASGAACEVKDICVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPM
GPPGDMPCPPGNDGLPGAPGIPGQRGEKGKPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQESILAVGGKVFSTNGQSATFDAIQEACARAGGHIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDETPVNYTNWYPGEPAGRGTEQCVEMYTDGRWNDRNCLY
NRLTICEF
Download sequence
Identical sequences 9544.ENSMMUP00000035875 XP_005565376.1.63531 XP_005565377.1.63531 XP_005565378.1.63531 XP_005565379.1.63531 ENSMMUP00000035875 ENSMMUP00000035875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]