SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036243 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000036243
Domain Number - Region: 2-81
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000392
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036243   Gene: ENSMMUG00000030712   Transcript: ENSMMUT00000043234
Sequence length 90
Comment pep:novel chromosome:MMUL_1:17:31433037:31442370:1 gene:ENSMMUG00000030712 transcript:ENSMMUT00000043234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLLRVFVEGRQHYFSDLLNILDTAITVIILLVDVIYIFFDIKFLKDVPRWTRLFRLLR
LIILIRVFHLAHLKRQLGKLIRRLVSGNKR
Download sequence
Identical sequences ENSMMUP00000036243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]