SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036261 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036261
Domain Number 1 Region: 358-554
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-48
Family cAMP-binding domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 112-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-36
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036261   Gene: ENSMMUG00000021187   Transcript: ENSMMUT00000043252
Sequence length 644
Comment pep:known chromosome:MMUL_1:13:98270263:98289935:1 gene:ENSMMUG00000021187 transcript:ENSMMUT00000043252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRSEIALAGSPECSSGPQGRLSRLIFWLRRWAVRHVHHHDQGLDPFPDRSRGAELKEV
SSQESNTQANVGSQEPADRGRSAWPLAKRNTNTSNNTEEEKKTKKKDAIVVDPSSNLYYR
WLTAIALPVFYNWCLLICRACFDELQSEYLMLWLLLDYSADVLYALDALVRARTGFLEQG
LMVSDTNRLWQHYKTTMQFKLDVLSLVPTDLAYLKVGMNYPELRFNRLLKFSRLFEFFDR
TETRTNYPNIFRIGNLVLYILVIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSR
KYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASR
AEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAI
NVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVV
ADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTE
YPEAKKALEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAE
YNATQMKMKQRLSQLESQVKGGGDNPLADGEVPGDATKTEDKQQ
Download sequence
Identical sequences ENSMMUP00000036261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]