SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036344 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036344
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000116
Family Complement control module/SCR domain 0.000016
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000032
Family Complement control module/SCR domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036344   Gene: ENSMMUG00000015151   Transcript: ENSMMUT00000043345
Sequence length 265
Comment pep:known chromosome:MMUL_1:9:6294671:6345475:-1 gene:ENSMMUG00000015151 transcript:ENSMMUT00000043345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHATFKAVAYKEGTMLNCECKRGFRRIKS
GSPYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSQMQLADQVS
LPGHCREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGETEPSQFPGEEEPQASPDGLPESETSRLVTTTDFRIQTEVAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQ
Download sequence
Identical sequences ENSMMUP00000019861 ENSMMUP00000036344 9544.ENSMMUP00000036344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]