SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036455 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036455
Domain Number 1 Region: 563-703,755-932
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.57e-78
Family Protein kinases, catalytic subunit 0.0000000000444
Further Details:      
 
Domain Number 2 Region: 242-319
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000486
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036455
Domain Number - Region: 66-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000565
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036455   Gene: ENSMMUG00000016139   Transcript: ENSMMUT00000043453
Sequence length 984
Comment pep:known_by_projection chromosome:MMUL_1:17:7656036:7719983:-1 gene:ENSMMUG00000016139 transcript:ENSMMUT00000043453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGCALRPQSAGT
VYEAATVEVDVSASITLQVLVDTPGNVSCLWVFKHSSLNCQPHFDVQNRGVVSMVILKMT
ETQAGEYLLFIQSEATNYTILFTVSIRNTLLFTLRRPYFRKMENQDALVCISESVPEPIV
EWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRECTRLFTIDLNQTPQ
TTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGSYFEMSTYSTNRTMIRILF
AFVSSVARNNTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYEIDQYEEFCFSVRFK
AYPQIRCTWTFSRKAFPCEQKALDDGYSVSKFCNHKHQPGEYIFHAENGDAQFTKMFTLN
IRRKPQVLAEASASQASCSSDGYPLPSWTWKKCSDKSPNCTEDIPEGVWNRKANRKVFGQ
WVSSSTLNMSEAMKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDSISFYATIGVCLLF
IVVLTMLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFRDCDYDLKWEFPRENLEFGK
VLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMSELKMMTQLGSHENI
VNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPN
SSMPGSRDVQIHPHSDPISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQ
VAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDSNYVVRGNNVNLKAR
LPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYKLIRNGFKMD
QPFYATEEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLEDAEEAMYQNVDGRVSERPHIY
QNRRPFSREMDSGPLSPKAQVEDS
Download sequence
Identical sequences ENSMMUP00000036455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]