SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036513 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036513
Domain Number 1 Region: 194-323
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-41
Family C-type lectin domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036513
Domain Number - Region: 73-219
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00152
Family HBL-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036513   Gene: ENSMMUG00000020855   Transcript: ENSMMUT00000043512
Sequence length 328
Comment pep:known_by_projection chromosome:MMUL_1:13:71137564:71143164:-1 gene:ENSMMUG00000020855 transcript:ENSMMUT00000043512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEREVPDAHFTVDKQNISLWPREPPPKSGPSLFPGKTPTVRAALICLTLVLVASILLQ
AVLYPRFMGNISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQTVNVSLDYVR
SQFLKLKTSVEKANAQIQILTRSWEEVGTLNAQIPELKSDLEKASALNTKIRALQGSLDN
MSKLLKRQNDILQVVSQGWKYFKGNFYYFSLITKTWYSAQQFCVSRNSHLTSVTSESEQE
FLYKTAGGLTYWIGLTKAGTEGDWFWVDDTPFDKVQSAKFWIPGEPNNAGNNEHCGNIRV
SSLQAWNDAQCDKTFLFICKRPYIPSEP
Download sequence
Identical sequences ENSMMUP00000036513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]