SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036528 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036528
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.3e-64
Family Alanine racemase-like, N-terminal domain 0.00000000108
Further Details:      
 
Domain Number 2 Region: 264-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.21e-46
Family Eukaryotic ODC-like 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036528   Gene: ENSMMUG00000030822   Transcript: ENSMMUT00000043527
Sequence length 461
Comment pep:known chromosome:MMUL_1:13:63450041:63452041:1 gene:ENSMMUG00000030822 transcript:ENSMMUT00000043527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFGNEEFDCHFLDEGFTAKGILDQKINEVSFSDDKDAFYVADLGDILKKHLRWLNALP
RVTPFYAVKCNDSKAIMKTLAAVGTGFDCASKTEIQLVQSLRVPPERIIYANPCKQVSQT
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCCLSVKFRATLRNSRLL
LERAKEVNIDVVGVSFHAGSGCTDPETFVQAISDTRCVFDMGAEVGFSMYLLDIGGGFPG
SEDVKLKFEEITSIINPALDRYFLSDSGVRIIAKPGRYYVASAFTLAVNIISKKIVLKEQ
TGSDDEDESSEQTFMCYVNYGVYGSFNCILYDHAHVKPLLQKRPKPDKKYYSSSIWGPIC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPVIYYVMSGPAWQLTQQF
QNPDFPPEVEEQDTSTLPVSCAWESGMKRHPAACALAGINV
Download sequence
Identical sequences ENSMMUP00000036528 ENSMMUP00000036528 9544.ENSMMUP00000036528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]