SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036654 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036654
Domain Number 1 Region: 49-247
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.47e-69
Family Phosphate binding protein-like 0.0000064
Further Details:      
 
Domain Number 2 Region: 248-287,321-342
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.000000000458
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036654   Gene: ENSMMUG00000014866   Transcript: ENSMMUT00000043661
Sequence length 351
Comment pep:known chromosome:MMUL_1:14:117491353:117499744:1 gene:ENSMMUG00000014866 transcript:ENSMMUT00000043661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAVSAEPVTSTLWASGRAVQQLAPGCHPQSLLEENSPKMRVIRVGTRKSQL
ARIQTDSVVATLKALYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEV
DLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRR
AAQLQRKFSHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEE
CMYAVGQEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQDTMQATIHVPAQHEDGPE
DDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDAH
Download sequence
Identical sequences ENSMMUP00000036654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]