SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036694 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036694
Domain Number 1 Region: 203-449
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-88
Family Eukaryotic proteases 0.0000976
Further Details:      
 
Domain Number 2 Region: 107-210
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-19
Family Hepsin, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036694   Gene: ENSMMUG00000030906   Transcript: ENSMMUT00000043702
Sequence length 453
Comment pep:known_by_projection chromosome:MMUL_1:14:112159669:112170469:-1 gene:ENSMMUG00000030906 transcript:ENSMMUT00000043702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLMLDDQAPAEAQYAEEGPGSGIFRAEPGDQQHPISQVVCWRSMRRGCAVLGALGLLAGM
GVGSWLLGQCWGPFSGQPLQVLQSPRSSSSCPTLPPSFPMWFSCISVSFRINSEDFLLEV
QVRDRPRWLLVCHEGWSPALGLQVCWSLGYLRLTHHKGVNLTDIKLNSSQEFAQLSPRLE
GFLEEVWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQAVAPGRWPWQASVALGFRHTC
GGSVLAPHWVVTAAHCMHFRLSRLSSWRVHAGLVSHSAVRPHQGAVVERIIPHPLYSAQN
HDYDVALLRLRTPLNFSDTVGAVCLPAKEQHFPKGSQCWVSGWGHTDSSHTYSSDMLQDT
VVPLLSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLVGVVS
WGLGCAEPNHPGVYTKVAEFLDWIHDTVQVSVG
Download sequence
Identical sequences 9544.ENSMMUP00000036694 ENSMMUP00000036694 ENSMMUP00000036694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]