SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036710 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036710
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-31
Family C-type lectin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036710   Gene: ENSMMUG00000030915   Transcript: ENSMMUT00000043719
Sequence length 380
Comment pep:known_by_projection chromosome:MMUL_1:14:110001546:110021643:1 gene:ENSMMUG00000030915 transcript:ENSMMUT00000043719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGTALQAVVLAMLLVGLRAATGRLLSASDLDLRGGQPVCRGGTQRPCYKVIYFHDTSR
RLNFEEAKEACRRDGGQLVSIESEDEQNLIEKFIENLLPSDGDFWIGLRRREEKQSNSTA
CEDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKN
NFICKYSDEKPAVPSREPEGEETEPTTPVLLEETQEEDAKKTFKESREAALNLAYILIPG
IPLLLLFVVSTVVCWVWSCRRRQQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSEAD
LAETRPDLKNISFRVCSGEATPDDVSCDYDNMAVNPSESGFVTLVSVESGFVTNDIYEFS
PDQIGRSKESGWVENEIYGY
Download sequence
Identical sequences 9544.ENSMMUP00000036710 ENSMMUP00000036711 ENSMMUP00000036710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]