SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036776 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036776
Domain Number 1 Region: 99-219
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-30
Family C-type lectin domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036776   Gene: ENSMMUG00000011872   Transcript: ENSMMUT00000043788
Sequence length 222
Comment pep:known chromosome:MMUL_1:13:3109686:3147685:1 gene:ENSMMUG00000011872 transcript:ENSMMUT00000043788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGEKGDSGDIGPPGPNGEP
GLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETDSKIYLLVKEEKRYADAQLS
CQGRGGTLGMPKDEAANGLMAAYLAQAGLARVFIGINDLEREGAFVYSDRSPMRTFNKWR
SGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKESM
Download sequence
Identical sequences ENSMMUP00000036776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]