SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036784 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036784
Domain Number 1 Region: 146-677
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.29e-167
Family Myeloperoxidase-like 0.000000000632
Further Details:      
 
Domain Number 2 Region: 684-740
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000667
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 733-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000221
Family EGF-like domain of nidogen-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036784   Gene: ENSMMUG00000009662   Transcript: ENSMMUT00000043797
Sequence length 782
Comment pep:known_by_projection chromosome:MMUL_1:13:1370175:1451716:1 gene:ENSMMUG00000009662 transcript:ENSMMUT00000043797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWAVLAVTLIMACTEAFFPFISRGKELLWGKPEESRVAGVLEESKRLVDTAMYATMQR
NLKKREILSPHQLLSFSKLPEPTSGEIARAAEIMETSIQAMKRKVNLKIQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRLITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPSILHNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFRGGADCQVTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFAPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYVPRILGPEAFQQYVGPYEGYDSAANPT
VSNVFSTAAFRFGHATIHPLVRRLDAGFQEHPGLPGLWLHETFFSPWTLLHGGYNEWREF
CGLPRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLI
GKQMKALRDGDWFWWENSHVFTDAQRHELEKHSLSRVICDNTGLTRVPVDAFRVGKFPED
FESCDSIPGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGH
EQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGGDGRT
CV
Download sequence
Identical sequences ENSMMUP00000036784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]