SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036830 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036830
Domain Number 1 Region: 11-113
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.83e-35
Family Nucleoplasmin-like core domain 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036830   Gene: ENSMMUG00000020577   Transcript: ENSMMUT00000028949
Sequence length 261
Comment pep:novel chromosome:MMUL_1:14:73247445:73248299:-1 gene:ENSMMUG00000020577 transcript:ENSMMUT00000028949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LADSMDLHMPLRPQNYLFSWEVKADKDYHFKVDNDENEHQLSLRTVSLGTGAKEELHIVE
AEAMNCEDSPIKVTLATLKMSVQPTVFLGGFVITPPYLKCGSGPIHISGQHLVAVEEDAE
SEDEEEEGVKLLSISRKQSAPGGGSKIPQKKETEEKAPVKKSIQDTPDKNAQKSNQNGKD
SKPSSTPTKNRKKLLKTPKGPSSVEDVKAKMQASIEKGGSLPKVEAKFISYVKNCFQMTG
QEAIQDLWQWRKSLEENSLSN
Download sequence
Identical sequences ENSMMUP00000036830 ENSMMUP00000036830 9544.ENSMMUP00000036830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]