SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036948 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036948
Domain Number 1 Region: 9-56
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.7e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036948   Gene: ENSMMUG00000031005   Transcript: ENSMMUT00000043951
Sequence length 57
Comment pep:known_by_projection chromosome:MMUL_1:10:86579099:86579272:1 gene:ENSMMUG00000031005 transcript:ENSMMUT00000043951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPLLAMSSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences G7PJZ3
ENSMMUP00000036948 ENSMMUP00000040142 9544.ENSMMUP00000036948 9544.ENSMMUP00000040142 ENSMMUP00000036948 ENSMMUP00000040142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]