SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036994 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036994
Domain Number 1 Region: 1136-1298,1326-1405
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 603-830
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.06e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 112-233,335-402
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.02e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1472-1694
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-28
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036994   Gene: ENSMMUG00000004878   Transcript: ENSMMUT00000043990
Sequence length 2041
Comment pep:known chromosome:MMUL_1:10:83498223:83614235:1 gene:ENSMMUG00000004878 transcript:ENSMMUT00000043990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESASPPSSAAAPAAEPGVTTEQPGPQSPPSSPPGLEEPLDGADPHVPHPDLAPVAFFC
LRQTTSPRNWCIKMVCNPYPPQPWLIGALQGLKDLGPVQPYRDPSVLLRRLRVQQVFDDF
IFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVR
VLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFL
EENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVY
DFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWVE
IMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLS
SSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQSRRQALGPEAPAPAKPGPHA
KEPRHYKLCPRHSPLDATPHTLVQPIPATLASDPASCPCCQHEAGRRPSGLGSTDSGQEG
SGSGSSAGGEDEADGDGTRSSEDRASSELGKEEEEEQQADGAVWLCGDVWRETRAKLRGI
VDSKYFNRGIMMAILVNTVSMGIEHHEQAKELTNILEICNVVFTSMFALEMILKLAAFGL
FDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLM
KTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQ
ILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYS
DDDQSSSNMEEFDKLQEGLDSSGDPKLFPIPMTPNGHLDPSLPLGGHLGPAGAAGPAPRL
SLQPDPMLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKH
KPPSAEHESLLSAERGGGARVCEVAGDEGLPRPAPLHAPHAPHAHHAHHGPHLAHRHRHH
RRTLSLDTRDSVDLAELVPTVGAHPRAAWRAAGPAPGHEDCNGRMPSIAKDVFTKMGDRR
DRGEDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFD
YVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQ
AYLRSSWNVLDGFLVFVSIIDIVVSLASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLK
LVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCMAAN
YRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFIS
FLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRSEWVPVEDFGA
GRKQMIQPLCPGLSHFSQHLSRMNVLPSLSPFPTSLETALKYCNYMFTTVFVLEAVLKLV
AFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLL
KMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHA
TFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDKRTCLNTLQFVSPLYFVSFVLTAQF
VLINVVVAVLMNHLDDSNKEAQEDAEMDAELELEMAHGLGPGPRLPAGSPGAPGRGPGGA
GGGGDAEGGLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCK
KCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGPKDSKGELDPPEPMCV
RDLDECFFPLSSTAVSPGPENFLCEMEEIPFNPVQSWLKHDSSQAPPSPFSPDASSPLLP
MPAEFFHPAVSASQKGPEKGTGTGTLPKIALQGSWASLRSPRVNCTLLRQATGSDTSLDA
SPSSSAGSLQTTLEDSLTLSDSPRRALGPPAPAPGPRAGLSPAAHRRLSLRGRGLFSLRG
L
Download sequence
Identical sequences ENSMMUP00000036994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]