SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037038 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037038
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.8e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000109
Further Details:      
 
Domain Number 2 Region: 75-147
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000000106
Family Ribosomal protein L11, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037038   Gene: ENSMMUG00000020453   Transcript: ENSMMUT00000028776
Sequence length 164
Comment pep:novel chromosome:MMUL_1:14:49958323:49958817:-1 gene:ENSMMUG00000020453 transcript:ENSMMUT00000028776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVHLRCTGGEVCATSALAPKIGPLGLSPKKVGDDIAKATGELKGLRITV
KLTIQNRQAQIQVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNTARQIQHRY
ARELSGTIKEILGTAQSVGCNVDGCHPHDIIDDINSGAMECPAS
Download sequence
Identical sequences ENSMMUP00000037038 ENSMMUP00000037038 9544.ENSMMUP00000037038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]