SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037130 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037130
Domain Number 1 Region: 441-697
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1355-1612
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-57
Family YWTD domain 0.00000311
Further Details:      
 
Domain Number 3 Region: 743-999
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000145
Further Details:      
 
Domain Number 4 Region: 1050-1303
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-48
Family YWTD domain 0.00000293
Further Details:      
 
Domain Number 5 Region: 264-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 354-433,689-737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000675
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 228-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 143-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 9 Region: 66-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 309-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1309-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000745
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 104-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 1005-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000598
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 26-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037130
Domain Number - Region: 1612-1649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000305
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037130   Gene: ENSMMUG00000013100   Transcript: ENSMMUT00000044124
Sequence length 1905
Comment pep:known_by_projection chromosome:MMUL_1:14:25202807:25263652:1 gene:ENSMMUG00000013100 transcript:ENSMMUT00000044124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQWGALLLGALLCAHGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDH
SDEDGCMLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG
YCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEE
SCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDS
GLCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSD
EENCENTGSPQCASDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNV
NNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHTCQDVNECADEGYCSQGCTNSEGAFQCWC
ETGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRE
LVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANL
DGAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWP
NGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHT
KSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNY
TCACPTGFRKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDW
DSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRI
EVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISS
NLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYW
TDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCLRS
PNPSGFSCTCPTGINLLPDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITM
KNTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYW
TDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGS
DRTVLISNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTL
LDSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGC
SHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVP
VPELNNVISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVAR
NLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERAN
LDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPF
ALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVN
NGGCTHLCFARASDFVCACPDERDSRPCSLVPGLVPPAPRSTGMSEKSPVLPNTLPTTLR
SSTTRTRMSLEEVEGRCSERDARLGLCARSNEAVPAAPGEGLHISYAIGGLLSILLILVV
IAALMLYRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDH
NYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGSLLRDHVCMKTDTVSIQASSGSLDDT
ETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
Download sequence
Identical sequences ENSMMUP00000037130 XP_014969841.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]