SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037317 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037317
Domain Number 1 Region: 79-166
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-16
Family C-type lectin domain 0.0069
Further Details:      
 
Domain Number 2 Region: 3-43
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000118
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037317   Gene: ENSMMUG00000019925   Transcript: ENSMMUT00000044303
Sequence length 240
Comment pep:known_by_projection chromosome:MMUL_1:10:63101582:63127661:-1 gene:ENSMMUG00000019925 transcript:ENSMMUT00000044303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELRCNPGQFACRSGTIQCIPLPWQCDGWATCEDESDEANCPEVTGEARPHHGKEAVDPRQ
GRTRGGDPTHFHAVNVAQPVRFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLN
GSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKG
ETLCDTMVHRRLLCPYVGTQHTHLKLGARFRGAPMWLGGALSVGPTPACEPHPGAKTLQV
Download sequence
Identical sequences ENSMMUP00000037317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]