SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037438 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037438
Domain Number 1 Region: 485-821
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.05e-116
Family Methionine synthase SAM-binding domain 0.0000000581
Further Details:      
 
Domain Number 2 Region: 2-200
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 6.02e-54
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0039
Further Details:      
 
Domain Number 3 Region: 328-478
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.31e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000273
Further Details:      
 
Domain Number 4 Region: 220-309
Classification Level Classification E-value
Superfamily Methionine synthase domain 4.97e-27
Family Methionine synthase domain 0.0000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037438   Gene: ENSMMUG00000010073   Transcript: ENSMMUT00000044422
Sequence length 822
Comment pep:known_by_projection chromosome:MMUL_1:1:220135752:220200201:-1 gene:ENSMMUG00000010073 transcript:ENSMMUT00000044422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSIRRLKKGQ
ATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIK
ETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHK
ELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKVIQTDEWRNGPVEERLEYALVKGIEK
HIIEDTEEARLNQERYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVG
HLIPFMEKEREETRVLNGTTEEEATDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRV
IDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATT
SRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYES
LKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQ
LRGKYPNRGFPKIFNDKTVGEEAKKVYDDAQNMLNTLINQKKLQARGVVGFWPAQSIQDD
IHLYTESAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVA
CFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADL
RRLRYEGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRLTESLAMAPASAVSGLYFSNL
KSKYFAVGKISRDQVEDYALRKNMAVAEVEKWLGPILGYDTD
Download sequence
Identical sequences ENSMMUP00000037438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]