SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037534 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037534
Domain Number 1 Region: 64-96,146-203
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-16
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037534   Gene: ENSMMUG00000007402   Transcript: ENSMMUT00000044522
Sequence length 254
Comment pep:known_by_projection chromosome:MMUL_1:14:8826660:8829764:1 gene:ENSMMUG00000007402 transcript:ENSMMUT00000044522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCLQNLGGVRQLTSLCSHPSHPSRVPATHRAPPPGPALPSRSQVPEVEPPAPTAPQQPA
MGCLRPWARYGLLVVAHLLTLGLGAVLFQALEGPPACRLRAELRAELAAFQAEHRACLPP
GALEELVGTALATQAHGVSSLGNSSEARNWDLPSVLLFTASILTTTGYGHMAPLSPGGKA
FCMVYAALGLPASLALVATLRHCLLPALSRPGAWVGPLAAVAGQGCAAAGSCTGPAGGRQ
LCAAASAGAVGPSG
Download sequence
Identical sequences ENSMMUP00000037534 ENSMMUP00000037536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]