SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037658 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037658
Domain Number 1 Region: 119-295
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000388
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000674
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037658   Gene: ENSMMUG00000005069   Transcript: ENSMMUT00000044634
Sequence length 341
Comment pep:known_by_projection chromosome:MMUL_1:1:200972815:201001074:1 gene:ENSMMUG00000005069 transcript:ENSMMUT00000044634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPI
VTWLMVRKINNWLNHANYGLIPEERTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSV
IFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGL
IKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARRENKPSWFGLCYCKALQSD
YITYIDELLTYINAKPKLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQ
WDRTFKVTKGRVVQESPSPFESFLKLFSFLALLVAIFLIVL
Download sequence
Identical sequences ENSMMUP00000037658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]