SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037678 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037678
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-33
Family C-type lectin domain 0.000000648
Further Details:      
 
Domain Number 2 Region: 242-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 302-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000876
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 180-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000011
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 359-427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 6 Region: 424-486
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037678   Gene: ENSMMUG00000016580   Transcript: ENSMMUT00000044656
Sequence length 547
Comment pep:known_by_projection chromosome:MMUL_1:1:199432366:199440202:-1 gene:ENSMMUG00000016580 transcript:ENSMMUT00000044656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNC
TALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSAPIPACKVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVP
VCEAFQCTALSNPERGYMNCLPSPSGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGM
LPTCEAPTESNTPLVAGLSAAGLSLLTLAPFLLWLRKCFRKAKKFVPASSCQSLESDGSY
QKPSYIL
Download sequence
Identical sequences ENSMMUP00000037678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]