SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037683 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037683
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-29
Family C-type lectin domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 261-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 199-266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 316-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 378-443
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 458-523
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 513-578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 161-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037683   Gene: ENSMMUG00000013044   Transcript: ENSMMUT00000044662
Sequence length 646
Comment pep:known_by_projection chromosome:MMUL_1:1:199296157:199325454:-1 gene:ENSMMUG00000013044 transcript:ENSMMUT00000044662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCQKAILYQRFRRVVFGIARLLCFSALISELTNQKEVAAWTYHYSTKAYSWNTSRKYCQ
NRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNE
PNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNY
TCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSK
LECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVGP
EVVQCTASGVWTAPAPVCKAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLR
GADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLL
LVGASVLQCLATGNWNSVPPECQVKSSIASLPSPGVQCPALTTPGQGTMHCRHHPGTFGF
NTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGNF
SYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTTG
LIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSS
Download sequence
Identical sequences ENSMMUP00000037683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]