SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037685 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037685
Domain Number 1 Region: 97-163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 400-465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 338-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 152-218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 35-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 276-342
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000973
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 213-280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000131
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 477-542
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 532-597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 2-31
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000791
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037685   Gene: ENSMMUG00000013044   Transcript: ENSMMUT00000044664
Sequence length 625
Comment pep:known_by_projection chromosome:MMUL_1:1:199294857:199325454:-1 gene:ENSMMUG00000013044 transcript:ENSMMUT00000044664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCSKQGECLETIGNYTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQ
CSFHCADGYQVNGPSKLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQ
SSCGFSCEEGFVLVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFA
YGSNCKFECQLGYRVRGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRA
FQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPF
GAFRYQSVCSFTCNEDLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQ
PLGSSSYKSTCHFICDEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDC
SDTHGEFNVGSTCHFSCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPAL
TTPGQGTMHCRHHPGTFGFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCP
ELHVNKPIVMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQDDG
KCPLNPHSHLGTYGVFTNAAFDPSS
Download sequence
Identical sequences ENSMMUP00000037685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]