SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037687 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000037687
Domain Number - Region: 103-177
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0293
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037687   Gene: ENSMMUG00000000971   Transcript: ENSMMUT00000044666
Sequence length 230
Comment pep:known_by_projection chromosome:MMUL_1:10:32635657:32675458:-1 gene:ENSMMUG00000000971 transcript:ENSMMUT00000044666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTLMDVLRHRPGWVEVKDEGEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRK
NYMVKNLKRFRKQLEREAGKLEAAKCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPDT
RSSDDQKDDIPVENYVAQRYIENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSN
TRFTLNSIDDQYVHLTNVAVQKTSPDYHPKKVAPGGQCVPVTDSQQPGRL
Download sequence
Identical sequences ENSMMUP00000037687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]