SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037759 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037759
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Histone-fold 2.68e-53
Family Nucleosome core histones 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037759   Gene: ENSMMUG00000031261   Transcript: ENSMMUT00000044740
Sequence length 136
Comment pep:novel chromosome:MMUL_1:1:194327059:194327469:1 gene:ENSMMUG00000031261 transcript:ENSMMUT00000044740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKQTARKSTSGKAPRKQLSTKATCKSEPSTGGVKKPHRYRPGTVALGEISRYQKSTE
FLIPKIPLQRLVREIAQDFKTDLRFQSAAMGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences ENSMMUP00000037759 9544.ENSMMUP00000037759 ENSMMUP00000037759 XP_005539890.1.63531 XP_014981090.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]