SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037764 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037764
Domain Number 1 Region: 11-199
Classification Level Classification E-value
Superfamily Ribosomal protein S2 2.49e-69
Family Ribosomal protein S2 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037764   Gene: ENSMMUG00000004941   Transcript: ENSMMUT00000044745
Sequence length 294
Comment pep:novel chromosome:MMUL_1:12:72799683:72800782:1 gene:ENSMMUG00000004941 transcript:ENSMMUT00000044745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYLSLEMGKSEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLA
ARAIVATENPADASVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPGL
LVVTDPRADHQPLMKASYVNLSTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLARE
VLHMCGTISREHPWEVMPDLYFYRDPEEIEKEEQAATEKAVTKEEFQGEWTAPAPEFTAT
QPEVADWSEGVQAPSVPIQQFPTEDWSAQPAMEDWSAAPTAQATEWVGATTEWS
Download sequence
Identical sequences ENSMMUP00000037764 ENSMMUP00000037764 9544.ENSMMUP00000037764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]