SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037981 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037981
Domain Number 1 Region: 126-181
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000769
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 2 Region: 11-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000433
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 64-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000057
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037981   Gene: ENSMMUG00000000240   Transcript: ENSMMUT00000044968
Sequence length 181
Comment pep:novel chromosome:MMUL_1:1:173636297:173638698:-1 gene:ENSMMUG00000000240 transcript:ENSMMUT00000044968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTCSKSDIEVENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQPI
CIKLCDMPVFENSRAKSNGMWFKLHDTLDYECYDGYESRYGNTTGSIVCGEDGWSHLPTC
YNSSEKCGPPPPISNGDTKSFPQKVYLPQSTVEYQCQSSYELQGSQYVTCSNGEWSEPPR
C
Download sequence
Identical sequences ENSMMUP00000037981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]