SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037982 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037982
Domain Number 1 Region: 65-120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000648
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 2 Region: 8-60
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000472
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037982   Gene: ENSMMUG00000000240   Transcript: ENSMMUT00000044969
Sequence length 120
Comment pep:novel chromosome:MMUL_1:1:173628789:173631226:-1 gene:ENSMMUG00000000240 transcript:ENSMMUT00000044969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCSKSDIEVENGFISESSSIYILNKEMQYKCKPGYATADGNSSGSITCLQNGWSAQPVCI
NSSEKCGPPPPISNADTKSFPQKVYLPQSTVEYQCQSSYELQGSQYVTCSNGEWSEPPRC
Download sequence
Identical sequences ENSMMUP00000037982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]