SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038003 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038003
Domain Number 1 Region: 112-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-32
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 337-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.02e-27
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 560-762
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-25
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 790-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000171
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 5 Region: 863-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 825-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 42-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000224
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038003
Domain Number - Region: 915-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000116
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 534-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00591
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 573-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0368
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038003   Gene: ENSMMUG00000012322   Transcript: ENSMMUT00000044989
Sequence length 942
Comment pep:known_by_projection chromosome:MMUL_1:1:173098597:173123649:-1 gene:ENSMMUG00000012322 transcript:ENSMMUT00000044989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRNSLCQPSRCLDGYLFFNRRMFAARTHGFHILMAMLIGIHCEEDVNECSSNPCQNGGT
CENLPGNYTCHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGICIPHFQDGQHGFGCLC
PSGYTGSLCEIATTLSFEGDGFLWVKTGSATTKGSVCNIALRFQTVQPVALLLFRGNRDV
FVKLELLSGYIHLSIQVNSQPKVLLYISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKC
ISKAPSPLESDQSICAFQNSFLGGLPVGTTSDGVALLKFYNIPSTPSFVGCLQDIKIDWN
HITLENISSVSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYKGPNCLREF
VAGRFGQNDSTGYVVFTLDESYGDTVSLSMFVQTLQPSGLLLALENSTYQYIRVWLEHGR
LAMLTPNSPKLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIQKGDVIY
IGGLPDKQETELNGGFFKGCIQDVRLNNQNLEFFPNSTNNVSLKPVLVNVTQGCPGDNSC
KSNPCRNGGVCHSLWDDFSCSCPAHMSGKACEEVQWCGFSPCPHEAQCQPVLQGFECIAN
AVFNEQSSQILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQ
LQSGNSFYTLSLTSLQSVNDGMWHEVTLSMTDPMSQTSRWQMEVDNQTPFVTSTIATGSL
NFLKDNTDIYVGDGAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFTNKPQEEQFLKISTN
SVVTGCLQLSVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNTDECFSNPCIHGNC
SDRVAAYHCTCEPGYTGGNCEVDIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRQ
SRLPSTVCGNEETNLTCYNGGNCTEFQAELKCMCRPGFTGER
Download sequence
Identical sequences ENSMMUP00000038003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]