SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038014 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038014
Domain Number 1 Region: 27-85
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 2.61e-18
Family Acyl-CoA thioesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038014   Gene: ENSMMUG00000012510   Transcript: ENSMMUT00000044999
Sequence length 92
Comment pep:known chromosome:MMUL_1:10:18638123:18641156:1 gene:ENSMMUG00000012510 transcript:ENSMMUT00000044999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPQAPEDGQGCGDRGDPPRDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQ
ALVAAAKSVSEDVHVHSLHCYFVRADAPMCSV
Download sequence
Identical sequences ENSMMUP00000038014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]