SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038044 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038044
Domain Number 1 Region: 1030-1185,1224-1302
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.88e-33
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 350-584
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.83e-33
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 1348-1531
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-24
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 1-115,165-193
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.02e-19
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038044   Gene: ENSMMUG00000017414   Transcript: ENSMMUT00000045028
Sequence length 1666
Comment pep:novel chromosome:MMUL_1:1:169397483:169444886:1 gene:ENSMMUG00000017414 transcript:ENSMMUT00000045028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVTTTKGAGLDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTC
YFTGTDIVATVENEEPSPCARTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVY
QCITMEGWTDVLYWVGLGPGLPEPSPFIHRKFKGSQGGEFTKEREKAKSRGTFQKLREKQ
QLDEDLRGYMSWITQGEVMDVEDFRLEQNHPVHHIRRTLGASGSSEHACCCFTLIRAELG
ENRFTFFCVSLDVGCRPAQHCAPSSVPSLSRHWRQWNRIFRWKCHDVVKSKVFYWLVILI
VALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTVEMLMKMYGLGLRQYFMSIFNRFDC
FVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIAS
LLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWTSMMY
NGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEER
KRRKMSNSEQTIRVLDMVTPTSVGKLLQPAHGDGNRDMLAFWTDRPQDAECQSLRARNGT
PVPVEARWKKRDQQWSSDISKELEPSWANHSGLPLCVAMGPCCVSGPLTIESQPLVWDPP
EGVVRLSRPLRTFWFGFHFGFSNSGVSQTSQRRRSPRWPRSWSRNPRVKASPPLPRQAGG
SSSPMVPLVPQSTGGIGWGGEGISPCLTGGRANEAISRDSCTEKHRLPNNANRLSSICSL
RGNRKFHLSGPRRGQAEPGWINLTRPPGRALGSKNSLSPGSFGPPVKEVCKVKYGEVQVR
WWLTDRKSEVRERILPPWELRISGTQLPHVVMRPSECAWNVCLFLYPLLPSPVPEATGIA
KHGKTPLIPPSLPTGDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKI
RVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIV
LKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAI
NRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEEC
RYTGQGARRDGDRIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEE
DVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCV
QYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQVRAPQETNHIS
DILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESAR
ISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMF
GKIALVDGTQINRNNNFQTFPQAVLLLFSLLRGQAGADVVRSCRPVDTSQLCDPNPGPPA
FLCWDSLFLLLQVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKH
LDVVTLLRRIQPPLGFGKFCPHRVACKVTRAARDGWPQGGEESPRH
Download sequence
Identical sequences 9544.ENSMMUP00000038044 ENSMMUP00000038047 ENSMMUP00000038044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]