SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038194 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038194
Domain Number 1 Region: 26-205
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.81e-85
Family MHC antigen-recognition domain 0.000000033
Further Details:      
 
Domain Number 2 Region: 208-300
Classification Level Classification E-value
Superfamily Immunoglobulin 4.28e-30
Family C1 set domains (antibody constant domain-like) 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038194   Gene: ENSMMUG00000010641   Transcript: ENSMMUT00000045178
Sequence length 339
Comment pep:known scaffold:MMUL_1:1099214738742:15732:19024:-1 gene:ENSMMUG00000010641 transcript:ENSMMUT00000045178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVMAPRTLLLVLSGVLALTQTQAGSHSMRYFYTAVSRPGRREPLFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWVEQEGPEYWDRETQNMKTATQTYRGNLRTLLRYYNQSEGGSHTIQ
KMYGCDLGPDGRLLRGYEQFAYDGRDYIILNEDLRSWTAADMAAQFTQRKWEAARAAEQH
RTYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDYEATLRCWALGFYPAEITLT
WQRDGEEQTEDTELVETRPTGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRFEP
FSQSTIPIVGIIAGLVLLGTVVTGAVVAAVMWRRKSSDR
Download sequence
Identical sequences ENSMMUP00000038194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]