SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038205 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038205
Domain Number 1 Region: 197-461
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 2 Region: 1057-1324
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-32
Family YWTD domain 0.0000408
Further Details:      
 
Domain Number 3 Region: 142-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000176
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 629-668
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 5 Region: 27-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000694
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 6 Region: 508-544
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 7 Region: 795-835
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 720-757
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 755-795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 843-880
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 12 Region: 109-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000247
Family EGF-type module 0.008
Further Details:      
 
Domain Number 13 Region: 593-632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 14 Region: 928-964
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 15 Region: 545-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 16 Region: 884-922
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 17 Region: 683-716
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 18 Region: 1009-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000175
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 19 Region: 1379-1412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 971-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000389
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000038205
Domain Number - Region: 6-27
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number - Region: 1333-1358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0035
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 466-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00486
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038205   Gene: ENSMMUG00000017143   Transcript: ENSMMUT00000045189
Sequence length 1663
Comment pep:known_by_projection chromosome:MMUL_1:12:32783121:32840373:-1 gene:ENSMMUG00000017143 transcript:ENSMMUT00000045189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QCKRYSRYRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDGSD
ELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGVNECHDPSISGC
DHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTETPFVCSQKCENVIGSYICKCAPGY
LREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLGNVVALDFDRVEKRLY
WIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVEWVSRKLYWLDARLDGLFVSDLNGG
HRRMLAQHCVDANNTFCFDNPRGLALHPQYGYIYWADWGHRAYIGRVGMDGTNKSVIIST
KLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHRRHTVYDGSLPHPFAITIFEDTIYW
TDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLCLI
KPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSDGS
DELALCPQRFCRLGQFQCNDGNCTSPQTLCNAHQNCPDGSDEDRLLCDNQTENHHCDSNE
WQCTNKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDN
DCGDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERT
CHPVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWIC
DHYNDCGDNSDERDCEMRTCHPEYFQCTSGHCVPSELKCDGTADCLDASDEADCPTRFPD
GAYCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLNVPCNSPNRFRCDNNRCIY
GHEVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPNDNVCDDADDCGDWSD
ELGCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCP
QHCRNTKGSYECVCADGFTSMSDHPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYL
QDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGHNNLVQEVDLKL
KYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGT
DWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYDGT
DRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRIFH
QLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPPCR
CMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVIIGALAI
AGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETSIDR
SMAMSEDFVMEMGKQPIIFENPMYSVRDSAVKVVQPTQRIVRPLICPQVTVSGNVDNKNY
GSPINPSEIVPETSPTSPAADGTQVTKWNLFKRKTKQTTNFENPIYAQMENEQKETVAAT
PPPSPSLPAKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV
Download sequence
Identical sequences ENSMMUP00000038205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]