SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038224 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038224
Domain Number 1 Region: 307-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-19
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 2 Region: 443-513
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 3 Region: 497-561
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-17
Family Complement control module/SCR domain 0.00062
Further Details:      
 
Domain Number 4 Region: 55-117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000983
Family Complement control module/SCR domain 0.0000384
Further Details:      
 
Domain Number 5 Region: 381-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000498
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 6 Region: 567-623
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 7 Region: 122-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000863
Family Complement control module/SCR domain 0.0000385
Further Details:      
 
Domain Number 8 Region: 248-298
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000135
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038224   Gene: ENSMMUG00000013602   Transcript: ENSMMUT00000045207
Sequence length 623
Comment pep:known_by_projection chromosome:MMUL_1:1:162882044:162894909:-1 gene:ENSMMUG00000013602 transcript:ENSMMUT00000045207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFGGENVLQKDNYNKRDKEVSYRYKPGYTLIGTNSVQRWQFSLNSETASEKFSGISCGSP
PPILNGRISHYSTPITLGTVIRYICSNGFRLIGEKNIICITKDKVVGIWDKPAPKCEYFN
KYSTCPEPIVPGGYKARGAEPPYIHGDFVTFACKTNFSMNGNKSVWCQANNKWGPTRLPT
CESGEYEKKGKCNSHSICILSQHLENNNNNKRLGNGDLKLPKVGLQHMFCIIQRPPEWNC
SMNSFRLECQAPPNILNGQKEDRHMVRFNPGTSIKYSCNPGYVLVREESIQCTSEGWQCV
KLQVQEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPEREVEFSLIGESTIRCTS
NDQERGTWSGPAPLCELSLLAVQCSHVHVANGYKISGKEAPYFYNDTVTFKCFNGFTLKG
SSQIRCKANNTWDPEIPVCEKGCQPPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLVG
NKSIHCMPSGNWSPSAPRCEVIHCHPPPVIVNGKHTGMKAENFLYGNEVSYECDQGFYLL
GEKKLQCRRHGSWSGPSPQCLQSPPGCQPPPKTPNGNHTGGNIARFSPGMSILYSCDQGY
LLVGEALLLCTHEGTWNRPAPHC
Download sequence
Identical sequences ENSMMUP00000038224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]