SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038356 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038356
Domain Number 1 Region: 181-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 243-303
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000031
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 57-113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000334
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 4 Region: 118-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000012
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038356   Gene: ENSMMUG00000012695   Transcript: ENSMMUT00000045331
Sequence length 491
Comment pep:known chromosome:MMUL_1:1:146885431:147033789:1 gene:ENSMMUG00000012695 transcript:ENSMMUT00000045331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSIGDGFLEQQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQACAD
PGVPENGFRTPSGGVFFEGSVTRFHCQDGFKLKGATKRLCMKYFNGTLGWIPSDKSICVQ
EECRIPQIEDAEIHNKTYRYGEKLIITCHEGFKIRYPDLYNMFSLCRDDGTWNNLPVCQG
CLRPLASTNGYVNISEFQISFPVGTVISYRCFPGFKLDGSAYLECLHNLIWSSSPPRCLA
LEVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQ
VYCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRS
SSSDPDFVVVDGVPVMLPSYDEAVSGGLSALGPGYLASVGQGCPLPVDDQSPPAYPGSGD
TDTGPGESEACDSVSGSSELLQSLYSPPRCQESTHPASDNPDTIASTVEEVASTSPGIDI
ADEIPLMEEDP
Download sequence
Identical sequences A0A2K5VIA2 A0A2K6B6V4 F7G9C8
XP_005540992.1.63531 XP_011733498.1.29376 XP_014971061.1.72884 ENSMMUP00000038356 ENSMMUP00000038364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]