SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038434 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038434
Domain Number 1 Region: 242-305
Classification Level Classification E-value
Superfamily RILP dimerisation region 7.72e-19
Family RILP dimerisation region 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038434   Gene: ENSMMUG00000008416   Transcript: ENSMMUT00000045406
Sequence length 333
Comment pep:known_by_projection chromosome:MMUL_1:11:124753894:124813831:-1 gene:ENSMMUG00000008416 transcript:ENSMMUT00000045406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWR
GEAQDLLSQIAQLQEENKQLMTNLSHKDVSFSEEEFQKHEGMSERERQVMKKLKEVVDKQ
RDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADL
QTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVALELKDPNRPR
FTLQELRDVLHERNELKSKLFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPESGI
KRLIFTAIMPMVAAGLIIDDPTLQPVRRLVSLV
Download sequence
Identical sequences ENSMMUP00000038434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]