SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038436 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038436
Domain Number 1 Region: 139-210
Classification Level Classification E-value
Superfamily RILP dimerisation region 4.58e-18
Family RILP dimerisation region 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038436   Gene: ENSMMUG00000031493   Transcript: ENSMMUT00000045408
Sequence length 216
Comment pep:known chromosome:MMUL_1:11:124694060:124715592:-1 gene:ENSMMUG00000031493 transcript:ENSMMUT00000045408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPVREEEEEEDDERDETEDEERDEAGPEGALGKSPFQLTTEDVYDISYLLGRELMAL
GSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDNLRKEVEGLRRQDPPTSGEVT
LSPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGG
RREKDAVVTRANNAGRNKEEKTIIKKLFFFRSGKQT
Download sequence
Identical sequences F7GKN7
ENSMMUP00000038436 NP_001247762.1.72884 XP_005572614.1.63531 ENSMMUP00000038436 9544.ENSMMUP00000038436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]